Protein Labeling Reagents
Cayman Chemical PhosphIn-bIotIn 500ug
A labeling reagent that selectively reacts with azido groups on modified proteins through the Staudinger ligation reaction; can be used in common avidin-based biochemical techniques in whole cells or by blotting experiments following SDS-PAGE; has been used successfully in conjunction with Daz-1 or Daz-2 to label and detect sulfenic acid sites in proteins
Cayman Chemical MyrIstIc AcId 5g
A saturated fatty acid; incorporated into myristoyl-CoA and transferred by N-myristoyltransferase to the N-terminal glycine of certain proteins
Cayman Chemical PropIdIum IodIde 10mg
A fluorescent probe commonly used to identify dead cells; excitation at 488-535 nm and emission maximum of 617 nm
Cayman Chemical CarbaprostacyclIn-bIotIn 500ug
An affinity probe which allows carbaprostacyclin to be detected in complexes with transmembrane receptors and/or nucleic or protein binding partners
LICOR IRDye 680RD NHS Ester (0.5 mg)
IRDye infrared dyes from LI-COR Biosciences are available for researchers developing applications using near-infrared (NIR) fluorescence. These unique dyes are used in a variety of NIR imaging applications including Western blotting, plate-based assays, protein arrays, tissue section imaging, and molecular activity measurements. Standard NHS ester chemistry is used to produce custom probes labeled with LI-COR IRDye infrared dyes. The NHS ester reactive group provides the functionality for labeling primary and secondary amines, such as lysine residues in proteins.
Medchemexpress LLC Biotin-PEG4-dialkoxydiphenylsilane-picolyl azide | 2599839-59-3 | MFCD00137487 | 95.0% | C47H67N9O10SSi | 10MG
A clickable, acid-cleavable biotinylated PEG4 azide designed as an enrichment handle for labeling and enriching cell-surface glycoproteins. It incorporates a picolyl azide for efficient bioorthogonal conjugation and a dialkoxydiphenylsilane linker that permits acid-triggered release following affinity capture, providing a workflow for selective labeling, capture, and release of target biomolecules.
- Enables copper-catalyzed azide-alkyne cycloaddition (CuAAC) for covalent labeling.
- Compatible with strain-promoted alkyne-azide cycloaddition (SPAAC) for copper-free reactions.
- Acid-cleavable dialkoxydiphenylsilane linker allows release after enrichment.
- PEG4 spacer improves solubility and reduces steric hindrance.
- Biotin enables strong affinity capture with streptavidin reagents.
- Supplied with typical purity of 95% for consistent labeling results.
AnaSpec AMYLOID (1-40) N-TERMINAL
Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
Medchemexpress LLC Mal-PEG10-NHS ester | 3055858-73-3 | 98.0% | 706.73 | 100 MG
Mal-PEG10-NHS ester is a PEG-based PROTAC linker designed for the synthesis of PROTACs. These molecules function by exploiting the intracellular ubiquitin-proteasome system to selectively degrade target proteins, connecting E3 ubiquitin ligase ligands with target protein ligands.
- PEG-based PROTAC linker
- Used in the synthesis of PROTACs
- Exploits the intracellular ubiquitin-proteasome system
- Selectively degrades target proteins
Sartorius Octet Amine Coupling Second Generation Reagent Kit
Amine Coupling Second Generation Reagent Kit is sufficient for 960 immobilizations onto Amine Reactive Second Generation (AR2G) Biosensors. For screening and kinetics biosensors only.
Lumiprobe Sulfo-Cyanine3 azide | 1658416-54-6 | 1 mg
Sulfo-Cyanine3 azide | Purity: 95% | Mol Wt: 736.94 | 1658416-54-6 | 1 mg